General Information

  • ID:  hor004591
  • Uniprot ID:  Q5R7H8
  • Protein name:  CThymosin beta-4
  • Gene name:  TMSB4X
  • Organism:  Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
  • Family:  Thymosin beta family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Pongo (genus), Ponginae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003779 actin binding; GO:0003785 actin monomer binding
  • GO BP:  GO:0007015 actin filament organization
  • GO CC:  GO:0005737 cytoplasm; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Length:  43(2-44)
  • Propeptide:  MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Signal peptide:  NA
  • Modification:  T1 N-acetylserine;T1 Phosphoserine;T3 N6-acetyllysine;T11 N6-acetyllysine;T22 Phosphothreonine;T25 N6-acetyllysine;T30 Phosphoserine;T31 N6-acetyllysine;T33 Phosphothreonine;T38 N6-acetyllysine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the organization of the cytoskeleton.
  • Mechanism:  Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
  • Cross BBB:  NA
  • Target:  ACTG1
  • Target Unid:   A0A6D2XWB9
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q5R7H8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004591_AF2.pdbhor004591_ESM.pdb

Physical Information

Mass: 567077 Formula: C210H348N56O77S
Absent amino acids: CHRVWY Common amino acids: K
pI: 4.72 Basic residues: 9
Polar residues: 9 Hydrophobic residues: 7
Hydrophobicity: -170.23 Boman Index: -14559
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 40.93
Instability Index: 6170.23 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA